HLA DP (HLA-DPA1) Rabbit Polyclonal Antibody

CAT#: TA342062

Rabbit Polyclonal Anti-HLA-DPA1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (2)
Transient overexpression lysate of major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 26 kDa
Gene Name major histocompatibility complex, class II, DP alpha 1
Background The specific function ofThis protein remains unknown.HLA-DPA1 belongs toThe HLA class II alpha chain paralogues.This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored inThe membrane. It plays a central role inThe immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages).The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodesThe leader peptide, exons 2 and 3 encodeThe two extracellular domains, exon 4 encodesThe transmembrane domain andThe cytoplasmic tail. WithinThe DP molecule bothThe alpha chain andThe beta chain containThe polymorphisms specifyingThe peptide binding specificities, resulting in up to 4 different molecules. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additional publications.
Synonyms DP(W3); DP(W4); HLA-DP1A; HLADP; HLASB; PLT1
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%
Reference Data
Protein Families Transmembrane
Protein Pathways Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...