PGAP3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PGAP3 antibody: synthetic peptide directed towards the N terminal of human PGAP3. Synthetic peptide located within the following region: AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	post-GPI attachment to proteins 3
Database Link	NP_219487 Entrez Gene 93210 Human UniProt ID Q96FM1
Background	PGAP3 is involved inThe lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist inThe generation of 2 saturated fatty chains atThe sn-2 position of GPI-anchors proteins. It is required for phospholipase A2 activity that removes an acyl-chain atThe sn-2 position of GPI-anchors duringThe remodeling of GPI.
Synonyms	AGLA546; CAB2; hCOS16; PERLD1; PP1498
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Guinea pig: 93%; Rat: 86%; Zebrafish: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.