LMF2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LMF2 antibody: synthetic peptide directed towards the middle region of human LMF2. Synthetic peptide located within the following region: YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	77 kDa
Gene Name	lipase maturation factor 2
Database Link	NP_149977 Entrez Gene 91289 Human UniProt ID Q9BU23
Background	LMF2 belongs toThe lipase maturation factor family. LMF2 is involved inThe maturation of specific proteins inThe endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) throughThe secretory pathway.
Synonyms	TMEM112B; TMEM153
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.