SMPD4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	sphingomyelin phosphodiesterase 4
Database Link	NP_060421 Entrez Gene 303790 Rat UniProt ID Q9NXE4
Background	The function ofThis protein remains unknown.
Synonyms	NET13; NSMASE-3; NSMASE3
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Metabolic pathways, Sphingolipid metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.