CLN6 Rabbit Polyclonal Antibody

CAT#: TA342044

Rabbit Polyclonal Anti-CLN6 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of ceroid-lipofuscinosis, neuronal 6, late infantile, variant (CLN6)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human ceroid-lipofuscinosis, neuronal 6, late infantile, variant (CLN6), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human ceroid-lipofuscinosis, neuronal 6, late infantile, variant (CLN6), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CLN6 antibody: synthetic peptide directed towards the middle region of human CLN6. Synthetic peptide located within the following region: LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 36 kDa
Gene Name ceroid-lipofuscinosis, neuronal 6, late infantile, variant
Background This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children.The genes responsible likely encode proteins involved inThe degradation of post-translationally modified proteins in lysosomes.The primary defect in NCL disorders is thought to be associated with lysosomal storage function. [provided by RefSeq, Oct 2008]
Synonyms CLN4A; HsT18960; nclf
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...