TMEM127 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM127 antibody: synthetic peptide directed towards the middle region of human TMEM127. Synthetic peptide located within the following region: AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	transmembrane protein 127
Database Link	NP_060319 Entrez Gene 55654 Human UniProt ID O75204
Background	This gene encodes a transmembrane protein with 3 predicted transmembrane domains.The protein is associated with a subpopulation of vesicular organelles corresponding to early endosomal structures, withThe Golgi, and with lysosomes, and may participate in protein trafficking betweenThese structures. Mutations inThis gene and several other genes cause pheochromocytomas. Alternatively spliced transcript variants encodingThe same protein have been identified. [provided by RefSeq, Aug 2010]
Synonyms	FLJ20507; FLJ22257
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.