RHBDL2 Rabbit Polyclonal Antibody
CAT#: TA342039
Rabbit Polyclonal Anti-RHBDL2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-RHBDL2 antibody is: synthetic peptide directed towards the N-terminal region of Human RHBDL2. Synthetic peptide located within the following region: ELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | rhomboid like 2 |
Database Link | |
Background | The protein encoded byThis gene is a member ofThe rhomboid family of integral membrane proteins.This family contains proteins that are related to Drosophila rhomboid protein. Members ofThis family are found in both prokaryotes and eukaryotes and are thought to function as intramembrane serine proteases.The encoded protein is thought to release soluble growth factors by proteolytic cleavage of certain membrane-bound substrates, including ephrin B2 and ephrin B3. [provided by RefSeq, Jul 2008] |
Synonyms | RRP2 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Protease, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |