TMEM161A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM161A antibody: synthetic peptide directed towards the middle region of human TMEM161A. Synthetic peptide located within the following region: LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	transmembrane protein 161A
Database Link	NP_060284 Entrez Gene 54929 Human UniProt ID Q9NX61
Background	The function ofThis protein remains unknown.
Synonyms	AROS-29
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.