ADA2 Rabbit Polyclonal Antibody
CAT#: TA342028
Rabbit Polyclonal Anti-CECR1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CECR1 antibody: synthetic peptide directed towards the N terminal of human CECR1. Synthetic peptide located within the following region: MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | cat eye syndrome chromosome region, candidate 1 |
Database Link | |
Background | This gene encodes a member of a subfamily ofThe adenosine deaminase protein family.The encoded protein is one of two adenosine deaminases found in humans, which regulate levels ofThe signaling molecule, adenosine.The encoded protein is secreted from monocytes undergoing differentiation and may regulate cell proliferation and differentiation.This gene may be responsible for some ofThe phenotypic features associated with cat eye syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Synonyms | ADA2; ADGF; IDGFL |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |