PCDH12 Rabbit Polyclonal Antibody

CAT#: TA342018

Rabbit Polyclonal Anti-PCDH12 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of protocadherin 12 (PCDH12)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human protocadherin 12 (PCDH12), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human protocadherin 12 (PCDH12), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PCDH12 antibody: synthetic peptide directed towards the middle region of human PCDH12. Synthetic peptide located within the following region: SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 126 kDa
Gene Name protocadherin 12
Background This gene belongs toThe protocadherin gene family, a subfamily ofThe cadherin superfamily.The encoded protein consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those ofThe classical cadherins.The gene localizes toThe region on chromosome 5 whereThe protocadherin gene clusters reside.The exon organization ofThis transcript is similar to that ofThe gene cluster transcripts, notablyThe first large exon, but no significant sequence homology exists.The function ofThis cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth. [provided by RefSeq, Jul 2008]
Synonyms VE-cadherin-2; VECAD2
Note Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 86%; Horse: 86%; Bovine: 85%; Guinea pig: 85%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...