KLRF1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KLRF1 antibody: synthetic peptide directed towards the middle region of human KLRF1. Synthetic peptide located within the following region: QKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	killer cell lectin like receptor F1
Database Link	NP_057607 Entrez Gene 51348 Human UniProt ID Q9NZS2
Background	KLRF1, an activating homodimeric C-type lectin-like receptor (CTLR), is expressed on nearly all natural killer (NK) cells and stimulatesTheir cytoxicity and cytokine release (Kuttruff et al., 2009 [PubMed 18922855]). [supplied by OMIM, Oct 2009]. Transcript Variant:This variant (KLRF1-s3) lacks three alternate coding exons that result in a frameshift inThe 3' coding region, compared to variant 1.The encoded isoform (KLRF1-s3) has a distinct C-terminus and is significantly shorter than isoform 1. ##Evidence-Data-START## Transcript exon combination :: AF267245.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025084, ERS025085 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms	CLEC5C; NKp80
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.