TMEM69 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM69 antibody: synthetic peptide directed towards the middle region of human TMEM69. Synthetic peptide located within the following region: AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	transmembrane protein 69
Database Link	NP_057570 Entrez Gene 51249 Human UniProt ID Q5SWH9
Background	The function remains unknown.
Synonyms	C1orf154
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Zebrafish: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.