Glycoprotein VI (GP6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GP6 antibody: synthetic peptide directed towards the middle region of human GP6. Synthetic peptide located within the following region: PPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	glycoprotein VI platelet
Database Link	NP_057447 Entrez Gene 51206 Human UniProt ID Q9HCN6
Background	This gene encodes a platelet membrane glycoprotein ofThe immunoglobulin superfamily.The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation.The encoded protein forms a complex withThe Fc receptor gamma-chain that initiatesThe platelet activation signaling cascade upon collagen binding. Mutations inThis gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, Dec 2011]
Synonyms	BDPLT11; GPIV; GPVI
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	ECM-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.