SDF4 Rabbit Polyclonal Antibody
CNY 4381.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SDF4 antibody: synthetic peptide directed towards the C terminal of human SDF4. Synthetic peptide located within the following region: KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 39 kDa |
| Gene Name | stromal cell derived factor 4 |
| Database Link | |
| Background | This gene encodes a stromal cell derived factor that is a member ofThe CREC protein family.The encoded protein contains six EF-hand motifs and calcium-binding motifs.This protein localizes toThe Golgi lumen and may be involved in regulating calcium dependent cellular activities. [provided by RefSeq, Sep 2011] |
| Synonyms | Cab45; SDF-4 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Goat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 86% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
