A4GNT Rabbit Polyclonal Antibody
CAT#: TA342000
Rabbit Polyclonal Anti-A4GNT Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the N terminal of human A4GNT. Synthetic peptide located within the following region: LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | alpha-1,4-N-acetylglucosaminyltransferase |
Database Link | |
Background | This gene encodes a protein fromThe glycosyltransferase 32 family.The enzyme catalyzesThe transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated withThe Golgi apparatus membrane. [provided by RefSeq, Jul 2008] |
Synonyms | alpha4GnT |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 83% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |