TMEM66 (SARAF) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM66 antibody: synthetic peptide directed towards the middle region of human TMEM66. Synthetic peptide located within the following region: TNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	store-operated calcium entry associated regulatory factor
Database Link	NP_057211 Entrez Gene 51669 Human UniProt ID Q96BY9
Background	TMEM66 is a multi-pass membrane protein. It belongs toThe TMEM66 family.The exact function of TMEM66 remains unknown.
Synonyms	FOAP-7; HSPC035; TMEM66; XTP3
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Pig: 90%; Bovine: 90%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.