DHRS7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dhrs7 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	dehydrogenase/reductase 7
Database Link	NP_057113 Entrez Gene 66375 Mouse UniProt ID Q9Y394
Background	The function of Dhrs7 remains unknown.
Synonyms	CGI-86; retDSR4; retSDR4; SDR34C1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.