PIGT Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PIGT antibody: synthetic peptide directed towards the N terminal of human PIGT. Synthetic peptide located within the following region: PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 64 kDa |
| Gene Name | phosphatidylinositol glycan anchor biosynthesis class T |
| Database Link | |
| Background | This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis.The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins toThe cell surface.This protein is an essential component ofThe multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring inThe endoplasmic reticulum, by catalyzingThe transfer of fully assembled GPI units to proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, May 2012] |
| Synonyms | CGI-06; MCAHS3; NDAP; PNH2 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Rabbit: 86% |
| Reference Data | |
| Protein Families | Transmembrane |
| Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
