PIGT Rabbit Polyclonal Antibody

CAT#: TA341989

Rabbit Polyclonal Anti-PIGT Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Transient overexpression lysate of phosphatidylinositol glycan anchor biosynthesis, class T (PIGT), transcript variant 3
    • 100 ug

CNY 3080.00


Transient overexpression lysate of phosphatidylinositol glycan anchor biosynthesis, class T (PIGT)
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PIGT antibody: synthetic peptide directed towards the C terminal of human PIGT. Synthetic peptide located within the following region: LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 64 kDa
Gene Name phosphatidylinositol glycan anchor biosynthesis class T
Background This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis.The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins toThe cell surface.This protein is an essential component ofThe multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring inThe endoplasmic reticulum, by catalyzingThe transfer of fully assembled GPI units to proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, May 2012]
Synonyms CGI-06; MCAHS3; NDAP; PNH2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Transmembrane
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...