LRRC8B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LRRC8B antibody: synthetic peptide directed towards the N terminal of human LRRC8B. Synthetic peptide located within the following region: PSTSSRLEHFVAILHKCFDSPWTTRALSETVAEQSVRPLKLSKSKILLSS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	92 kDa
Gene Name	leucine-rich repeat containing 8 family member B
Database Link	NP_056165 Entrez Gene 23507 Human UniProt ID Q6P9F7
Background	Component ofThe volume-regulated anion channel (VRAC, also named VSOAC channel), an anion channel required to maintain a constant cell volume in response to extracellular or intracellular osmotic changes.The VRAC channel conducts iodide better than chloride and may also conduct organic osmolytes like taurine. It is unclear whether LRRC8B constitutes a pore-forming subunit or whether it is closely associated withThe pore.
Synonyms	TA-LRRP; TALRRP
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.