ADCY6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	125 kDa
Gene Name	adenylate cyclase 6
Database Link	NP_066193 Entrez Gene 112 Human UniProt ID O43306
Background	This gene encodes adenylate cyclase 6, which is a membrane-associated enzyme and catalyzesThe formation ofThe secondary messenger cyclic adenosine monophosphate (cAMP).The expression ofThis gene is found in normal thyroid and brain tissues, as well as some tumors; and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue. Alternative splicing generates 2 transcript variants. [provided by RefSeq, Jul 2008]
Synonyms	AC6
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Melanogenesis, Oocyte meiosis, Progesterone-mediated oocyte maturation, Purine metabolism, Taste transduction, Vascular smooth muscle contraction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.