Syndecan 3 (SDC3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Sdc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	syndecan 3
Database Link	NP_055469 Entrez Gene 20970 Mouse UniProt ID O75056
Background	Cell surface proteoglycan that may bear heparan sulfate. May have a role inThe organization of cell shape by affectingThe actin cytoskeleton, possibly by transferring signals fromThe cell surface in a sugar-dependent mechanism.
Synonyms	SDCN; SYND3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Cell adhesion molecules (CAMs), ECM-receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.