ERVWE1 (ERVW-1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ERVWE1 antibody: synthetic peptide directed towards the N terminal of human ERVWE1. Synthetic peptide located within the following region: TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	endogenous retrovirus group W member 1
Database Link	NP_055405 Entrez Gene 30816 Human UniProt ID Q9UQF0
Background	Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction.This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations inThe gag and pol genes.This gene isThe envelope glycoprotein gene which appears to have been selectively preserved.The gene's protein product is expressed inThe placental syncytiotrophoblast and is involved in fusion ofThe cytotrophoblast cells to formThe syncytial layer ofThe placenta.The protein hasThe characteristics of a typical retroviral envelope protein, including a furin cleavage site that separatesThe surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encodingThe same protein have been found forThis gene. [provided by RefSeq, Mar 2010]
Synonyms	ENV; ENVW; ERVWE1; HERV-7q; HERV-W-ENV; HERV7Q; HERVW; HERVWENV
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 91%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.