FJX1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FJX1 antibody: synthetic peptide directed towards the N terminal of human FJX1. Synthetic peptide located within the following region: MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	four jointed box 1
Database Link	NP_055159 Entrez Gene 24147 Human UniProt ID Q86VR8
Background	The protein encoded byThis gene isThe human ortholog of mouse and Drosophila four-jointed gene product.The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development ofThe eyes.The exact function ofThis gene in humans is not known. [provided by RefSeq, Jul 2008]
Synonyms	FLJ22416; FLJ25593
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.