MTCH1 Rabbit Polyclonal Antibody
CAT#: TA341932
Rabbit Polyclonal Anti-Mtch1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Mtch1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MSNALSTVTRGSMKKVFPPDEIEQVSNKDDMKTSLKKVVKETSYEMMMQC |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | mitochondrial carrier 1 |
Database Link | |
Background | MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis. |
Synonyms | CGI-64; PIG60; PSAP; SLC25A49 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |