MTCH1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MTCH1 antibody: synthetic peptide directed towards the C terminal of human MTCH1. Synthetic peptide located within the following region: NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	mitochondrial carrier 1
Database Link	NP_055156 Entrez Gene 23787 Human UniProt ID Q9NZJ7
Background	This gene encodes a member ofThe mitochondrial carrier family.The encoded protein is localized toThe mitochondrion inner membrane and induces apoptosis independent ofThe proapoptotic proteins Bax and Bak. Pseudogenes on chromosomes 6 and 11 have been identified forThis gene. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Oct 2012]
Synonyms	CGI-64; PIG60; PSAP; SLC25A49
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.