PCDHA4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PCDHA4 antibody: synthetic peptide directed towards the C terminal of human PCDHA4. Synthetic peptide located within the following region: SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	99 kDa
Gene Name	protocadherin alpha 4
Database Link	NP_061730 Entrez Gene 56144 Human UniProt ID Q9UN74
Background	This gene is a member ofThe protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters.The alpha gene cluster is composed of 15 cadherin superfamily genes related toThe mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences.The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes inThe cluster.The large, uninterrupted N-terminal exons each encode six cadherin ectodomains whileThe C-terminal exons encodeThe cytoplasmic domain.These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role inThe establishment and function of specific cell-cell connections inThe brain. Alternative splicing has been observed and additional variants have been suggested butTheir full-length nature has yet to be determined. [provided by RefSeq, Jul 2008]
Synonyms	CNR1; CNRN1; CRNR1; PCDH-ALPHA4
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.