PILRB Rabbit Polyclonal Antibody
CAT#: TA341920
Rabbit Polyclonal Anti-PILRB Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PILRB antibody: synthetic peptide directed towards the middle region of human PILRB. Synthetic peptide located within the following region: KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | paired immunoglobin-like type 2 receptor beta |
Database Link | |
Background | The paired immunoglobin-like type 2 receptors consist of highly related activating and inhibitory receptors that are involved inThe regulation of many aspects ofThe immune system.The paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7.This gene encodesThe activating member ofThe receptor pair and contains a truncated cytoplasmic tail relative to its inhibitory counterpart (PILRA), that has a long cytoplasmic tail with immunoreceptor tyrosine-based inhibitory (ITIM) motifs.This gene is thought to have arisen from a duplication ofThe inhibitory PILRA gene and evolved to acquire its activating function. [provided by RefSeq, Jun 2013] |
Synonyms | FDFACT1; FDFACT2 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |