PILRA Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PILRA antibody: synthetic peptide directed towards the N terminal of human PILRA. Synthetic peptide located within the following region: IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	paired immunoglobin like type 2 receptor alpha
Database Link	NP_840057 Entrez Gene 29992 Human UniProt ID Q9UKJ1
Background	Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central toThe regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors andTheir non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation.These paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7.This particular gene encodesThe ITIM-bearing member ofThe receptor pair, which functions inThe inhibitory role. Alternative splicing has been observed atThis locus and three variants, each encoding a distinct isoform, are described. [provided by RefSeq, Jul 2008]
Synonyms	FDF03
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.