ALG6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: YEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	ALG6, alpha-1,3-glucosyltransferase
Database Link	NP_037471 Entrez Gene 29929 Human UniProt ID Q9Y672
Background	This gene encodes a member ofThe ALG6/ALG8 glucosyltransferase family.The encoded protein catalyzesThe addition ofThe first glucose residue toThe growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations inThis gene are associated with congenital disorders of glycosylation type Ic. [provided by RefSeq, Jul 2008]
Synonyms	CDG1C
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Metabolic pathways, N-Glycan biosynthesis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.