Synaptogyrin 4 (SYNGR4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SYNGR4 antibody: synthetic peptide directed towards the N terminal of human SYNGR4. Synthetic peptide located within the following region: MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSSLLTDGYQNKM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	synaptogyrin 4
Database Link	NP_036583 Entrez Gene 23546 Human UniProt ID O95473
Background	This gene encodes an integral membrane protein.The gene belongs toThe synaptogyrin gene family. Like other members ofThe familyThe protein contains four transmembrane regions.The exact function ofThis protein is unclear. [provided by RefSeq, Jul 2008]
Synonyms	MGC125805
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Guinea pig: 92%; Dog: 86%; Rabbit: 86%; Bovine: 85%; Horse: 79%; Rat: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.