TIM 1 (HAVCR1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HAVCR1 antibody: synthetic peptide directed towards the N terminal of human HAVCR1. Synthetic peptide located within the following region: CHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	hepatitis A virus cellular receptor 1
Database Link	NP_036338 Entrez Gene 26762 Human UniProt ID Q96D42
Background	The protein encoded byThis gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4.The encoded protein may be involved inThe moderation of asthma and allergic diseases.The reference genome represents an allele that retains a MTTVP amino acid segment that confers protection against atopy in HHAV seropositive individuals. Three transcript variants encodingThe same protein have been found forThis gene. [provided by RefSeq, Mar 2010]
Synonyms	HAVCR; HAVCR-1; KIM-1; KIM1; TIM; TIM-1; TIM1; TIMD-1; TIMD1
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.