B3GAT3 Rabbit Polyclonal Antibody
CAT#: TA341900
Rabbit Polyclonal Anti-B3GAT3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-B3GAT3 antibody: synthetic peptide directed towards the N terminal of human B3GAT3. Synthetic peptide located within the following region: PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | beta-1,3-glucuronyltransferase 3 |
Database Link | |
Background | The protein encoded byThis gene is a member ofThe glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars andTheir anomeric linkages.This gene product catalyzesThe formation ofThe glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction inThe final step ofThe biosynthesis ofThe linkage region of proteoglycans. A pseudogene ofThis gene has been identified on chromosome 3. [provided by RefSeq, Dec 2013] |
Synonyms | GLCATI; glcUAT-I; JDSCD |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Goat: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |