BACE1 Rabbit Polyclonal Antibody

CAT#: TA341892

Rabbit Polyclonal Anti-BACE1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 51 kDa
Gene Name beta-secretase 1
Background Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which isThe protein encoded byThis gene.The encoded protein, a member ofThe peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly inThe Golgi. Multiple transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, May 2011]
Synonyms ASP2; BACE; HSPC104
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 91%
Reference Data
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...