TMED3 Rabbit Polyclonal Antibody
CAT#: TA341889
Rabbit Polyclonal Anti-TMED3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TMED3 antibody: synthetic peptide directed towards the C terminal of human TMED3. Synthetic peptide located within the following region: DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | transmembrane p24 trafficking protein 3 |
Database Link | |
Background | The function remains known. |
Synonyms | C15orf22; P24B; p26 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |