SEC63 Rabbit Polyclonal Antibody

CAT#: TA341887

Rabbit Polyclonal Anti-SEC63 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of SEC63 homolog (S. cerevisiae) (SEC63)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human SEC63 homolog (S. cerevisiae) (SEC63), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human SEC63 homolog (S. cerevisiae) (SEC63), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SEC63 antibody: synthetic peptide directed towards the N terminal of human SEC63. Synthetic peptide located within the following region: WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 88 kDa
Gene Name SEC63 homolog, protein translocation regulator
Background The Sec61 complex isThe central component ofThe protein translocation apparatus ofThe endoplasmic reticulum (ER) membrane.The protein encoded byThis gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation intoThe ER.The Sec61-Sec62-Sec63 complex might also performThe backward transport of ER proteins that are subject toThe ubiquitin-proteasome-dependent degradation pathway.The encoded protein is an integral membrane protein located inThe rough ER. [provided by RefSeq, Jul 2008]
Synonyms DNAJC23; ERdj2; PRO2507; SEC63L
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 77%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...