SEC63 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SEC63 antibody: synthetic peptide directed towards the C terminal of human SEC63. Synthetic peptide located within the following region: WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	88 kDa
Gene Name	SEC63 homolog, protein translocation regulator
Database Link	NP_009145 Entrez Gene 11231 Human UniProt ID Q9UGP8
Background	The Sec61 complex isThe central component ofThe protein translocation apparatus ofThe endoplasmic reticulum (ER) membrane.The protein encoded byThis gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation intoThe ER.The Sec61-Sec62-Sec63 complex might also performThe backward transport of ER proteins that are subject toThe ubiquitin-proteasome-dependent degradation pathway.The encoded protein is an integral membrane protein located inThe rough ER. [provided by RefSeq, Jul 2008]
Synonyms	DNAJC23; ERdj2; PRO2507; SEC63L
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.