RER1 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RER1 antibody: synthetic peptide directed towards the middle region of human RER1. Synthetic peptide located within the following region: GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 23 kDa |
| Gene Name | retention in endoplasmic reticulum sorting receptor 1 |
| Database Link | |
| Background | The protein encoded byThis gene is a multi-pass membrane protein that is localized toThe golgi apparatus. It is involved inThe retention of endoplasmic reticulum (ER) membrane proteins inThe ER and retrieval of ER membrane proteins fromThe early Golgi compartment to facilitate gamma-secretase complex assembly. [provided by RefSeq, Oct 2009] |
| Synonyms | RP4-740C4.2 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
| Reference Data | |
| Protein Families | Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
