TMED1 Rabbit Polyclonal Antibody
CAT#: TA341867
Rabbit Polyclonal Anti-TMED1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TMED1 antibody: synthetic peptide directed towards the middle region of human TMED1. Synthetic peptide located within the following region: FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 23 kDa |
Gene Name | transmembrane p24 trafficking protein 1 |
Database Link | |
Background | This gene belongs toThe TMED (transmembrane emp24 domain-containing) protein family, which is involved inThe vesicular trafficking of proteins.The protein encoded byThis gene was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1) and may play a role in innate immunity.This protein lacks any similarity to other interleukin 1 ligands. Alternative splicing results in multiple transcript variants ofThis gene. [provided by RefSeq, Jul 2013] |
Synonyms | Il1rl1l; IL1RL1LG; p24g1; Tp24 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 77% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |