MMP24 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MMP24 antibody: synthetic peptide directed towards the middle region of human MMP24. Synthetic peptide located within the following region: GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	matrix metallopeptidase 24
Database Link	NP_006681 Entrez Gene 10893 Human UniProt ID Q9Y5R2
Background	Proteins ofThe matrix metalloproteinase (MMP) family are involved inThe breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However,The protein encoded byThis gene is a member ofThe membrane-type MMP (MT-MMP) subfamily; each member ofThis subfamily contains a potential transmembrane domain suggesting thatThese proteins are expressed atThe cell surface rather than secreted.This protein activates MMP2 by cleavage.The gene has previously been referred to as MMP25 but has been renamed MMP24. [provided by RefSeq, Jul 2008]
Synonyms	MMP-24; MMP25; MT-MMP 5; MT-MMP5; MT5-MMP; MT5MMP; MTMMP5
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.