VAMP5 Rabbit Polyclonal Antibody

CAT#: TA341852

Rabbit Polyclonal Anti-VAMP5 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of vesicle-associated membrane protein 5 (myobrevin) (VAMP5)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human vesicle-associated membrane protein 5 (myobrevin) (VAMP5), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human vesicle-associated membrane protein 5 (myobrevin) (VAMP5), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 13 kDa
Gene Name vesicle associated membrane protein 5
Background Synaptobrevins/VAMPs, syntaxins, andThe 25-kD synaptosomal-associated protein areThe main components of a protein complex involved inThe docking and/or fusion of vesicles and cell membranes.The VAMP5 gene is a member ofThe vesicle-associated membrane protein (VAMP)/synaptobrevin family andThe SNARE superfamily.This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008]
Synonyms MYOBREVIN; myobrevin; vesicle-associated membrane protein 5; vesicle-associated membrane protein 5 (myobrevin)
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transmembrane
Protein Pathways SNARE interactions in vesicular transport
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...