Thrb Rabbit Polyclonal Antibody
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 7106.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB, ChIP |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the n terminal of mouse Thrb. Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 |
Gene Name | thyroid hormone receptor beta |
Database Link | |
Background | Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine. |
Synonyms | ERBA-BETA; ERBA2; GRTH; MGC126109; MGC126110; NR1A2; OTTHUMP00000208475; OTTHUMP00000208531; PRTH; THR1; THRB1; THRB2 |
Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |