Tfam Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Tfam antibody: synthetic peptide directed towards the C terminal of mouse Tfam. Synthetic peptide located within the following region: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	transcription factor A, mitochondrial
Database Link	NP_033386 Entrez Gene 21780 Mouse UniProt ID P40630
Background	TFAM a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated thatThis protein is required to regulateThe mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns Sayre syndrome was produced when expression ofThe gene was eliminated by targeted disruption in heart and muscle cells.
Synonyms	MTTF1; MtTF1; MTTFA; mtTFA; OTTHUMP00000019633; TCF6; TCF6L1; TCF6L2; TCF6L3
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.