Tcea2 Rabbit Polyclonal Antibody
CAT#: TA341817
Rabbit Polyclonal Anti-Tcea2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Rat |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Tcea2 antibody is: synthetic peptide directed towards the middle region of Rat Tcea2. Synthetic peptide located within the following region: SVNALRKQSSDEELIALAKSLIKSWKKLLDVSDGKSRDQGRGTPLPTSSS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | transcription elongation factor A (SII), 2 |
Database Link | |
Background | SII class transcription elongation factor; releases RNA polmerase II ternary complexes from transcriptional arrest at arresting sites; necessary for RNA polymerase II transcription elongation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: D12927.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS160522, ERS160537 [ECO:0000348] ##Evidence-Data-END## |
Synonyms | OTTHUMP00000031638; TFIIS |
Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |