c Rel (REL) Rabbit Polyclonal Antibody
CNY 4628.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse, Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Rel antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 65 kDa |
Gene Name | REL proto-oncogene, NF-kB subunit |
Database Link | |
Background | The function ofThis protein remains unknown. |
Synonyms | C-Rel |
Note | Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Human: 86%; Bovine: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |