LHX5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Lhx5 antibody: synthetic peptide directed towards the middle region of mouse Lhx5. Synthetic peptide located within the following region: FFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	44 kDa
Gene Name	LIM homeobox 5
Database Link	NP_071758 Entrez Gene 16873 Mouse UniProt ID Q9H2C1
Background	Plays an essential role inThe regulation of neuronal differentiation and migration during development ofThe central nervous system.
Synonyms	MGC129689
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 75%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.