IRF1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	interferon regulatory factor 1
Database Link	NP_002189 Entrez Gene 16362 Mouse UniProt ID P10914
Background	Irf1 specifically binds toThe upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and activates those genes.Irf1 acts as a tumor suppressor.
Synonyms	IRF-1; MAR
Note	Immunogen Sequence Homology: Mouse: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Sheep: 85%; Bovine: 85%; Rabbit: 85%; Dog: 83%; Horse: 83%; Human: 83%; Yeast: 83%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.