Elf3 Rabbit Polyclonal Antibody
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Mouse, Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Elf3 antibody: synthetic peptide directed towards the N terminal of mouse Elf3. Synthetic peptide located within the following region: MAATCEISNVFSNYFNAMYSSEDPTLAPAPPTTFGTEDLVLTLNNQQMTL |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 41 kDa |
| Gene Name | E74-like factor 3 |
| Database Link | |
| Background | Elf3 is a transcriptional activator that binds and transactivates ETS sequences containingThe consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivateThe SPRR2A promoter and with RUNX1 to transactivateThe ANGPT1 promoter (By similarity). It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity). It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector ofThe ERBB2 signaling pathway (By similarity). It may be associated with mammary gland development and involution. It plays an important role inThe regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development. |
| Synonyms | EPR-1; ERT; ESE-1; ESX; JEN; OTTHUMP00000034052 |
| Note | Immunogen Sequence Homology: Mouse: 100%; Rat: 93% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
