NOTO Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Noto antibody: synthetic peptide directed towards the n terminal of mouse Noto. Synthetic peptide located within the following region: VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	notochord homeobox
Database Link	NP_001127934 Entrez Gene 384452 Mouse UniProt ID A8MTQ0
Background	Noto is a transcription regulator acting downstream of both FOXA2 and T during notochord development.Noto is required for node morphogenesis.Noto is essential for cilia formation inThe posterior notochord (PNC) and for left-right patterning; acts upstream of FOXJ1 and RFX3 inThis process and is required forThe expression of various components important for axonemal assembly and function. Plays a role in regulating axial versus paraxial cell fate.
Synonyms	Noto
Note	Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Human: 93%; Guinea pig: 93%; Rabbit: 92%; Bovine: 86%; Dog: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.