CACNB4 Rabbit Polyclonal Antibody
CAT#: TA341725
Rabbit Polyclonal Anti-CACNB4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
CNY 9998.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the middle region of human CACNB4. Synthetic peptide located within the following region: FDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRISSLAEVQSEIERIF |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 50 kDa |
| Gene Name | calcium voltage-gated channel auxiliary subunit beta 4 |
| Database Link | |
| Background | This gene encodes a member ofThe beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediateThe influx of calcium ions intoThe cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each ofThese subunits exist, either expressed from similar genes orThe result of alternative splicing.The protein encoded byThis locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controllingThe alpha-1 subunit membrane targeting and shiftingThe voltage dependence of activation and inactivation. Certain mutations inThis gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME). Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2009] |
| Synonyms | CAB4; CACNLB4; EA5; EIG9; EJM; EJM4; EJM6 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Families | Druggable Genome, Ion Channels: Other |
| Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
